| Description | Retinoic acid receptor beta |
|---|---|
| Organism | Homo sapiens |
| Chain | A |
| Length | 239 |
| Binding Area (Å2) | 437.71 |
| Molecular Weight | - |
| Aromaticity | 0.06 |
| Instability | - |
| Isoelectric Point | 5.50 |
| Sequence | ESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLEX |
| Description | Nuclear receptor coactivator 1 |
|---|---|
| Organism | Homo sapiens |
| Chain | C |
| Length | 8 |
| Binding Area (Å2) | 497.46 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1020.27 |
| Aromaticity | 0.00 |
| Instability | 62.96 |
| Isoelectric Point | 11.00 |
| Sequence | KILHRLLQ |
Is the complex classified in the same cluster?