| Description | Estrogen receptor |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 237 |
| Binding Area (Å2) | 450.14 |
| Molecular Weight | - |
| Aromaticity | 0.06 |
| Instability | - |
| Isoelectric Point | 6.31 |
| Sequence | KNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLEXAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKXKNVVPLSDLLLEMLDAHRX |
| Description | Nuclear receptor coactivator 1 |
|---|---|
| Organism | Homo sapiens |
| Chain | G |
| Length | 10 |
| Binding Area (Å2) | 527.21 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1286.53 |
| Aromaticity | 0.00 |
| Instability | 95.31 |
| Isoelectric Point | 8.76 |
| Sequence | HKILHRLLQE |
Is the complex classified in the same cluster?