| Description | Nuclear receptor ROR-gamma |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 246 |
| Binding Area (Å2) | 458.40 |
| Molecular Weight | - |
| Aromaticity | 0.10 |
| Instability | - |
| Isoelectric Point | 8.26 |
| Sequence | PYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSX |
| Description | co-activator peptide |
|---|---|
| Organism | Homo sapiens |
| Chain | D |
| Length | 8 |
| Binding Area (Å2) | 529.50 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1020.27 |
| Aromaticity | 0.00 |
| Instability | 62.96 |
| Isoelectric Point | 11.00 |
| Sequence | KILHRLLQ |
Is the complex classified in the same cluster?