| Description | Nuclear receptor ROR-gamma |
|---|---|
| Organism | Homo sapiens |
| Chain | D |
| Length | 246 |
| Binding Area (Å2) | 472.80 |
| Molecular Weight | - |
| Aromaticity | 0.10 |
| Instability | - |
| Isoelectric Point | 8.19 |
| Sequence | YASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLSKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTX |
| Description | Nuclear receptor-interacting protein 1 |
|---|---|
| Organism | Homo sapiens |
| Chain | S |
| Length | 10 |
| Binding Area (Å2) | 541.43 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1106.36 |
| Aromaticity | 0.00 |
| Instability | 33.11 |
| Isoelectric Point | 6.71 |
| Sequence | VTLLQLLLGH |
Is the complex classified in the same cluster?