| Description | Uncharacterized protein |
|---|---|
| Organism | Nomascus leucogenys |
| Chain | A |
| Length | 244 |
| Binding Area (Å2) | 448.68 |
| Molecular Weight | 28428.60 |
| Aromaticity | 0.10 |
| Instability | 40.35 |
| Isoelectric Point | 8.15 |
| Sequence | YASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFS |
| Description | Nuclear receptor coactivator 1 |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 9 |
| Binding Area (Å2) | 503.39 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1149.39 |
| Aromaticity | 0.00 |
| Instability | 78.48 |
| Isoelectric Point | 8.76 |
| Sequence | KILHRLLQE |
Is the complex classified in the same cluster?