| Description | Retinoic acid receptor beta |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 242 |
| Binding Area (Å2) | 466.36 |
| Molecular Weight | - |
| Aromaticity | 0.06 |
| Instability | - |
| Isoelectric Point | 5.69 |
| Sequence | ESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMMEXX |
| Description | Steroid Receptor Coactivator 1 |
|---|---|
| Organism | Homo sapiens |
| Chain | F |
| Length | 11 |
| Binding Area (Å2) | 539.47 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1442.71 |
| Aromaticity | 0.00 |
| Instability | 105.06 |
| Isoelectric Point | 10.84 |
| Sequence | RHKILHRLLQE |
Is the complex classified in the same cluster?