| Description | Estrogen receptor |
|---|---|
| Organism | Homo sapiens |
| Chain | A |
| Length | 231 |
| Binding Area (Å2) | 384.30 |
| Molecular Weight | - |
| Aromaticity | 0.06 |
| Instability | - |
| Isoelectric Point | 6.17 |
| Sequence | ALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYGLLLEMLDAHRLX |
| Description | Nuclear receptor coactivator 2 |
|---|---|
| Organism | Homo sapiens |
| Chain | C |
| Length | 6 |
| Binding Area (Å2) | 495.89 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 763.97 |
| Aromaticity | 0.00 |
| Instability | 40.43 |
| Isoelectric Point | 9.76 |
| Sequence | ILHRLL |
Is the complex classified in the same cluster?