| Description | Estrogen receptor |
|---|---|
| Organism | Homo sapiens |
| Chain | A |
| Length | 230 |
| Binding Area (Å2) | 484.35 |
| Molecular Weight | - |
| Aromaticity | 0.06 |
| Instability | - |
| Isoelectric Point | 5.92 |
| Sequence | NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRX |
| Description | Nuclear receptor coactivator 2 |
|---|---|
| Organism | Homo sapiens |
| Chain | C |
| Length | 10 |
| Binding Area (Å2) | 546.02 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1272.50 |
| Aromaticity | 0.00 |
| Instability | 95.31 |
| Isoelectric Point | 8.76 |
| Sequence | HKILHRLLQD |
Is the complex classified in the same cluster?