| Description | Microtubule-associated proteins 1A/1B light chain 3B |
|---|---|
| Organism | Mus musculus |
| Chain | B |
| Length | 122 |
| Binding Area (Å2) | 523.62 |
| Molecular Weight | 14301.30 |
| Aromaticity | 0.09 |
| Instability | 60.60 |
| Isoelectric Point | 8.28 |
| Sequence | EKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV |
| Description | Ankyrin-2 |
|---|---|
| Organism | Homo sapiens |
| Chain | D |
| Length | 13 |
| Binding Area (Å2) | 644.59 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1605.65 |
| Aromaticity | 0.08 |
| Instability | 108.45 |
| Isoelectric Point | 3.57 |
| Sequence | EEWVIVSDEEIEE |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S1698) |
Contact cluster (C24) |
Interface cluster (I39) |
|---|---|---|---|
| 5cx3-E-A | |||
| 5cx3-F-B | |||
| 5cx3-G-C | |||
| 5cx3-H-D | |||
| 5d94-B-A | |||
| 5dpw-H-G | |||
| 5dpw-J-I | |||
| 5dpw-N-M | |||
| 2k6q-B-A | |||
| 2zjd-B-A | |||
| 2zjd-D-C | |||
| 5wrd-C-A | |||
| 5e6o-G-C | |||
| 5e6o-H-A | |||
| 6a9x-A-D | |||
| 6aaf-B-A | |||
| 6hoi-F-B | |||
| 6hol-C-A | |||
| 6hol-D-B | |||
| 5l83-D-A | |||
| 5lxh-E-A | |||
| 5lxh-F-B | |||
| 5lxh-G-C | |||
| 4xc2-F-B | |||
| 5yip-B-A |