| Description | Autophagy-related protein 8 |
|---|---|
| Organism | Schizosaccharomyces pombe |
| Chain | A |
| Length | 112 |
| Binding Area (Å2) | 933.45 |
| Molecular Weight | 13126.94 |
| Aromaticity | 0.12 |
| Instability | 43.99 |
| Isoelectric Point | 7.98 |
| Sequence | RSQFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSDIAAIDKKKYLVPSDLTVGQFVYVIRKRIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSEDGFLYITYSGEN |
| Description | Transmembrane protein 184 homolog C30D11.06c |
|---|---|
| Organism | Schizosaccharomyces pombe |
| Chain | B |
| Length | 22 |
| Binding Area (Å2) | 1077.32 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 2719.01 |
| Aromaticity | 0.14 |
| Instability | 35.05 |
| Isoelectric Point | 4.18 |
| Sequence | LQFEIDDEMEPLYNQAKQMRYG |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S1711) |
Contact cluster (C24) |
Interface cluster (I45) |
|---|---|---|---|
| 6hol-D-B | |||
| 5l83-D-A | |||
| 5lxh-E-A | |||
| 5lxh-F-B | |||
| 5lxh-G-C | |||
| 4xc2-F-B | |||
| 5yip-B-A | |||
| 6a9x-A-D | |||
| 6hoi-F-B | |||
| 6hol-C-A | |||
| 5l83-C-B | |||
| 2l8j-B-A | |||
| 5azf-C-A | |||
| 5cx3-H-D | |||
| 5d94-B-A | |||
| 5dpw-H-G | |||
| 5dpw-J-I | |||
| 5dpw-N-M | |||
| 2k6q-B-A | |||
| 2zjd-B-A | |||
| 2zjd-D-C | |||
| 5wrd-C-A | |||
| 5yis-D-B | |||
| 5cx3-E-A | |||
| 5cx3-F-B | |||
| 5cx3-G-C |