| Description | Gamma-aminobutyric acid receptor-associated protein-like 1 |
|---|---|
| Organism | Homo sapiens |
| Chain | A |
| Length | 115 |
| Binding Area (Å2) | 531.11 |
| Molecular Weight | 13782.56 |
| Aromaticity | 0.15 |
| Instability | 39.78 |
| Isoelectric Point | 7.86 |
| Sequence | SMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESV |
| Description | Cysteine protease ATG4B |
|---|---|
| Organism | Homo sapiens |
| Chain | E |
| Length | 10 |
| Binding Area (Å2) | 679.70 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1209.26 |
| Aromaticity | 0.10 |
| Instability | 78.50 |
| Isoelectric Point | 3.39 |
| Sequence | EDEDFEILSL |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S212) |
Contact cluster (C24) |
Interface cluster (I45) |
|---|---|---|---|
| 5lxh-F-B | |||
| 5lxh-G-C | |||
| 4xc2-F-B | |||
| 5yip-B-A | |||
| 6a9x-A-D | |||
| 6aaf-B-A | |||
| 6hoi-F-B | |||
| 6hol-C-A | |||
| 6hol-D-B | |||
| 5l83-D-A | |||
| 2l8j-B-A | |||
| 5azf-C-A | |||
| 5l83-C-B | |||
| 2zjd-B-A | |||
| 2zjd-D-C | |||
| 5wrd-C-A | |||
| 5cx3-E-A | |||
| 5cx3-F-B | |||
| 5yis-D-B | |||
| 5cx3-G-C | |||
| 5cx3-H-D | |||
| 5d94-B-A | |||
| 5dpw-H-G | |||
| 5dpw-J-I | |||
| 5dpw-N-M | |||
| 2k6q-B-A | |||
| 5nq0-C-A | |||
| 3l6x-B-A | |||
| 5nq1-C-A | |||
| 5nq1-F-D | |||
| 6j2i-C-A | |||
| 1ty4-D-B | |||
| 6j2i-F-D |