| Description | Microtubule-associated proteins 1A/1B light chain 3A |
|---|---|
| Organism | Homo sapiens |
| Chain | D |
| Length | 117 |
| Binding Area (Å2) | 674.89 |
| Molecular Weight | 13841.81 |
| Aromaticity | 0.10 |
| Instability | 60.80 |
| Isoelectric Point | 9.10 |
| Sequence | RPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF |
| Description | FYVE and coiled-coil domain-containing protein 1 |
|---|---|
| Organism | Homo sapiens |
| Chain | H |
| Length | 16 |
| Binding Area (Å2) | 803.38 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1852.02 |
| Aromaticity | 0.06 |
| Instability | 32.75 |
| Isoelectric Point | 3.33 |
| Sequence | DAVFDIITDEELCQIQ |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S66) |
Contact cluster (C24) |
Interface cluster (I39) |
|---|---|---|---|
| 5wrd-C-A | |||
| 5cx3-F-B | |||
| 5cx3-G-C | |||
| 5d94-B-A | |||
| 2zjd-B-A | |||
| 2zjd-D-C | |||
| 5yis-D-B | |||
| 5cx3-E-A | |||
| 5dpw-H-G | |||
| 5dpw-J-I | |||
| 5dpw-N-M | |||
| 2k6q-B-A | |||
| 5e6o-G-C | |||
| 5e6o-H-A | |||
| 5lxh-G-C | |||
| 5yip-B-A | |||
| 4xc2-F-B | |||
| 6a9x-A-D | |||
| 6aaf-B-A | |||
| 6hoi-F-B | |||
| 6hol-C-A | |||
| 6hol-D-B | |||
| 5l83-D-A | |||
| 5lxh-E-A | |||
| 5lxh-F-B | |||
| 3ll8-E-A |