5YIP-B-A

PDB Title CRYSTAL STRUCTURE OF ANKG LIR/GABARAPL1 COMPLEX
Resolution (Å) 1.850
Classification SIGNALING PROTEIN

Protein

Description Gamma-aminobutyric acid receptor-associated protein-like 1
Organism Mus musculus
Chain A
Length 123
Binding Area (Å2) 748.03
Molecular Weight 14618.46
Aromaticity 0.15
Instability 37.41
Isoelectric Point 8.04
Sequence GPGSEFMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Peptide

Description Ankyrin-3
Organism Rattus norvegicus
Chain B
Length 23
Binding Area (Å2) 924.10
Hydrophobic (% a.a.)
30%
Molecular Weight 2661.70
Aromaticity 0.09
Instability 75.00
Isoelectric Point 4.25
Sequence PEDDWTEFSSEEIREARQAAASH

Clustering Classification

Sequence cluster S 382
Contact cluster C24
Interface cluster I45

Similar complexes

Is the complex classified in the same cluster?

Complex Sequence cluster
(S382)
Contact cluster
(C24)
Interface cluster
(I45)
6a9x-A-D
5l83-D-A
5lxh-E-A
5lxh-F-B
5lxh-G-C
4xc2-F-B
6aaf-B-A
6hoi-F-B
6hol-C-A
6hol-D-B
2l8j-B-A
5azf-C-A
5l83-C-B
2k6q-B-A
2zjd-B-A
2zjd-D-C
5wrd-C-A
5yis-D-B
5cx3-E-A
5cx3-F-B
5cx3-G-C
5cx3-H-D
5d94-B-A
5dpw-H-G
5dpw-J-I
5dpw-N-M