| Description | Gamma-aminobutyric acid receptor-associated protein |
|---|---|
| Organism | Mus musculus |
| Chain | D |
| Length | 117 |
| Binding Area (Å2) | 706.51 |
| Molecular Weight | 13917.86 |
| Aromaticity | 0.15 |
| Instability | 46.09 |
| Isoelectric Point | 8.73 |
| Sequence | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
| Description | Ankyrin-3 |
|---|---|
| Organism | Rattus norvegicus |
| Chain | A |
| Length | 18 |
| Binding Area (Å2) | 872.14 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 2140.18 |
| Aromaticity | 0.11 |
| Instability | 72.71 |
| Isoelectric Point | 4.08 |
| Sequence | DDWTEFSSEEIREARQAA |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S382) |
Contact cluster (C24) |
Interface cluster (I45) |
|---|---|---|---|
| 5yip-B-A | |||
| 4xc2-F-B | |||
| 6aaf-B-A | |||
| 6hoi-F-B | |||
| 6hol-C-A | |||
| 6hol-D-B | |||
| 5l83-D-A | |||
| 5lxh-E-A | |||
| 5lxh-F-B | |||
| 5lxh-G-C | |||
| 5azf-C-A | |||
| 5l83-C-B | |||
| 2l8j-B-A | |||
| 2zjd-D-C | |||
| 5wrd-C-A | |||
| 5yis-D-B | |||
| 5cx3-E-A | |||
| 5cx3-F-B | |||
| 5cx3-G-C | |||
| 5cx3-H-D | |||
| 5d94-B-A | |||
| 5dpw-H-G | |||
| 5dpw-J-I | |||
| 5dpw-N-M | |||
| 2k6q-B-A | |||
| 2zjd-B-A |