6HOL-C-A

PDB Title STRUCTURE OF ATG14 LIR MOTIF BOUND TO GABARAPL1
Resolution (Å) 1.400
Classification SIGNALING PROTEIN

Protein

Description Gamma-aminobutyric acid receptor-associated protein-like 1
Organism Homo sapiens
Chain A
Length 116
Binding Area (Å2) 510.02
Molecular Weight 13912.68
Aromaticity 0.16
Instability 37.41
Isoelectric Point 8.69
Sequence KFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Peptide

Description Beclin 1-associated autophagy-related key regulator
Organism Homo sapiens
Chain C
Length 10
Binding Area (Å2) 660.14
Hydrophobic (% a.a.)
40%
Molecular Weight 1260.35
Aromaticity 0.20
Instability 83.92
Isoelectric Point 4.37
Sequence DWENLPSPRF

Clustering Classification

Sequence cluster S 327
Contact cluster C24
Interface cluster I45

Similar complexes

Is the complex classified in the same cluster?

Complex Sequence cluster
(S327)
Contact cluster
(C24)
Interface cluster
(I45)
6hol-D-B
6a9x-A-D
6aaf-B-A
6hoi-F-B
5l83-D-A
5lxh-E-A
5lxh-F-B
5lxh-G-C
4xc2-F-B
5yip-B-A
5azf-C-A
5l83-C-B
2l8j-B-A
5yis-D-B
5cx3-E-A
5cx3-F-B
5cx3-G-C
5cx3-H-D
5d94-B-A
5dpw-H-G
5dpw-J-I
5dpw-N-M
2k6q-B-A
2zjd-B-A
2zjd-D-C
5wrd-C-A