| Description | Protein lgg-1 |
|---|---|
| Organism | Caenorhabditis elegans |
| Chain | A |
| Length | 124 |
| Binding Area (Å2) | 362.44 |
| Molecular Weight | - |
| Aromaticity | 0.13 |
| Instability | - |
| Isoelectric Point | 8.75 |
| Sequence | GPHMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGXXXXX |
| Description | peptide from Autophagy-related protein 19 |
|---|---|
| Organism | Saccharomyces cerevisiae |
| Chain | C |
| Length | 4 |
| Binding Area (Å2) | 598.15 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 575.61 |
| Aromaticity | 0.25 |
| Instability | 89.00 |
| Isoelectric Point | 3.79 |
| Sequence | WEEL |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S55) |
Contact cluster (C1309) |
Interface cluster (I45) |
|---|---|---|---|
| 6a9x-A-D | |||
| 6aaf-B-A | |||
| 6hoi-F-B | |||
| 2l8j-B-A | |||
| 6hol-C-A | |||
| 4xc2-F-B | |||
| 6hol-D-B | |||
| 5l83-C-B | |||
| 5l83-D-A | |||
| 5lxh-E-A | |||
| 5lxh-F-B | |||
| 5lxh-G-C | |||
| 5yip-B-A | |||
| 5b1z-C-A | |||
| 5b1z-D-B | |||
| 5e6o-G-C | |||
| 5e6o-H-A | |||
| 5fcg-C-A |