| Description | Protein lgg-2 |
|---|---|
| Organism | Caenorhabditis elegans |
| Chain | A |
| Length | 117 |
| Binding Area (Å2) | 400.78 |
| Molecular Weight | 13772.65 |
| Aromaticity | 0.09 |
| Instability | 90.59 |
| Isoelectric Point | 8.48 |
| Sequence | PGSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG |
| Description | TRP-GLU-GLU-LEU |
|---|---|
| Organism | Scheffersomyces stipitis |
| Chain | H |
| Length | 4 |
| Binding Area (Å2) | 571.98 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 575.61 |
| Aromaticity | 0.25 |
| Instability | 89.00 |
| Isoelectric Point | 3.79 |
| Sequence | WEEL |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S55) |
Contact cluster (C492) |
Interface cluster (I39) |
|---|---|---|---|
| 5e6o-G-C | |||
| 5cx3-E-A | |||
| 5cx3-F-B | |||
| 5cx3-G-C | |||
| 5cx3-H-D | |||
| 5d94-B-A | |||
| 5dpw-H-G | |||
| 5dpw-J-I | |||
| 5dpw-N-M | |||
| 2k6q-B-A | |||
| 5wrd-C-A | |||
| 2zjd-B-A | |||
| 5yis-D-B | |||
| 2zjd-D-C | |||
| 5fcg-C-A | |||
| 5azf-C-A | |||
| 5b1z-C-A | |||
| 5b1z-D-B |