| Description | GABA(A) receptor-associated protein |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 117 |
| Binding Area (Å2) | 656.06 |
| Molecular Weight | 13804.65 |
| Aromaticity | 0.15 |
| Instability | 46.09 |
| Isoelectric Point | 8.13 |
| Sequence | AMGFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG |
| Description | Kelch repeat and BTB domain-containing protein 6 |
|---|---|
| Organism | Homo sapiens |
| Chain | F |
| Length | 11 |
| Binding Area (Å2) | 825.27 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1306.38 |
| Aromaticity | 0.18 |
| Instability | 12.03 |
| Isoelectric Point | 3.93 |
| Sequence | SDDDFWVRVAP |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S1495) |
Contact cluster (C24) |
Interface cluster (I45) |
|---|---|---|---|
| 6a9x-A-D | |||
| 6aaf-B-A | |||
| 6hoi-F-B | |||
| 6hol-C-A | |||
| 6hol-D-B | |||
| 5l83-D-A | |||
| 5lxh-E-A | |||
| 5lxh-F-B | |||
| 5lxh-G-C | |||
| 5yip-B-A | |||
| 5l83-C-B | |||
| 2l8j-B-A | |||
| 5azf-C-A | |||
| 5cx3-E-A | |||
| 5cx3-F-B | |||
| 5cx3-G-C | |||
| 5cx3-H-D | |||
| 5d94-B-A | |||
| 5dpw-H-G | |||
| 5dpw-J-I | |||
| 5dpw-N-M | |||
| 2k6q-B-A | |||
| 2zjd-B-A | |||
| 5wrd-C-A | |||
| 2zjd-D-C | |||
| 5yis-D-B |