Description | Induced myeloid leukemia cell differentiation protein Mcl-1 homolog |
---|---|
Organism | Mus musculus |
Chain | A |
Length | 162 |
Binding Area (Å2) | 924.31 |
Molecular Weight | 18232.43 |
Aromaticity | 0.09 |
Instability | 34.62 |
Isoelectric Point | 8.20 |
Sequence | GPLGSEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGG |
Description | Bcl-2-binding component 3 |
---|---|
Organism | Mus musculus |
Chain | B |
Length | 27 |
Binding Area (Å2) | 1048.22 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 3319.62 |
Aromaticity | 0.07 |
Instability | 67.47 |
Isoelectric Point | 4.77 |
Sequence | EEEWAREIGAQLRRIADDLNAQYERRM |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S35) |
Contact cluster (C53) |
Interface cluster (I55) |
---|---|---|---|
2jm6-A-B | |||
2rod-B-A | |||
5c6h-B-A | |||
5uum-C-A | |||
5uum-D-B | |||
2kbw-B-A | |||
6mbe-B-A | |||
6qfi-B-A | |||
3d7v-B-A | |||
3kz0-C-A | |||
3kz0-D-B | |||
4uf1-B-A | |||
6mbc-B-A | |||
4zif-B-A | |||
2m04-B-A | |||
4zih-B-A | |||
6qg8-B-A | |||
2v6q-B-A | |||
5fmk-B-A | |||
2vog-B-A | |||
5twa-D-A | |||
2voh-B-A | |||
5twa-C-B | |||
2wh6-B-A | |||
5tzp-B-A | |||
2xpx-B-A | |||
5tzq-C-B | |||
5tzq-D-A | |||
3i1h-B-A | |||
5ua5-B-A | |||
3io8-D-C | |||
5uuk-B-A | |||
1bxl-B-A | |||
1g5j-B-A | |||
3mqp-B-A | |||
5vmo-B-A | |||
2jby-B-A | |||
4bd6-C-A | |||
6fbx-B-A |