Description | Bcl-2-like protein FPV039 |
---|---|
Organism | Fowlpox virus |
Chain | A |
Length | 132 |
Binding Area (Å2) | 777.57 |
Molecular Weight | 15658.83 |
Aromaticity | 0.16 |
Instability | 28.99 |
Isoelectric Point | 7.65 |
Sequence | MKDETYYIALNMIQNYIIEYNTNKPRKSFVIDSISYDVLKAACKSVIKTNYNEFDIIISRNIDFNVIVTQVLEDKINWGRIITIIAFCAYYSKKVPQYYDGIISEAITDAILSKYRSWFIDQDYWNGIRIYK |
Description | Bcl-2-modifying factor |
---|---|
Organism | Gallus gallus |
Chain | D |
Length | 22 |
Binding Area (Å2) | 928.38 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 2634.03 |
Aromaticity | 0.05 |
Instability | 18.55 |
Isoelectric Point | 9.50 |
Sequence | ARTEVQIARKLQCIADQFHRLH |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S35) |
Contact cluster (C276) |
Interface cluster (I295) |
---|---|---|---|
5tzp-B-A | |||
5tzq-C-B | |||
2voh-B-A | |||
5ua5-B-A | |||
2wh6-B-A | |||
5uuk-B-A | |||
2xpx-B-A | |||
5uum-C-A | |||
3i1h-B-A | |||
5uum-D-B | |||
3io8-D-C | |||
5vmo-B-A | |||
3mqp-B-A | |||
6fbx-B-A | |||
4bd6-C-A | |||
6mbc-B-A | |||
1bxl-B-A | |||
4uf1-B-A | |||
6qg8-B-A | |||
1g5j-B-A | |||
4zif-B-A | |||
2jby-B-A | |||
4zih-B-A | |||
2jm6-A-B | |||
5c6h-B-A | |||
2m04-B-A | |||
5fmk-B-A | |||
2roc-B-A | |||
5twa-D-A | |||
2rod-B-A | |||
5twa-C-B | |||
2v6q-B-A | |||
2vog-B-A |