Description | Protein BFL-1 |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 141 |
Binding Area (Å2) | 681.20 |
Molecular Weight | 16363.57 |
Aromaticity | 0.13 |
Instability | 20.82 |
Isoelectric Point | 5.25 |
Sequence | CEFGYIYRLAQDYLQVLQIPPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP |
Description | Apoptosis regulator BAK |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 16 |
Binding Area (Å2) | 790.44 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1724.92 |
Aromaticity | 0.00 |
Instability | 11.39 |
Isoelectric Point | 5.96 |
Sequence | GQVGRQLAIIGDDINR |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S35) |
Contact cluster (C75) |
Interface cluster (I84) |
---|---|---|---|
3mqp-B-A | |||
6mbc-B-A | |||
2vog-B-A | |||
2voh-B-A | |||
5uuk-B-A | |||
4zeq-B-A | |||
2vm6-B-A | |||
2voi-B-A | |||
5uum-D-B | |||
1bxl-B-A | |||
4bd6-C-A | |||
5vmo-B-A | |||
1g5j-B-A | |||
4uf1-B-A | |||
6fbx-B-A | |||
2jby-B-A | |||
2jm6-A-B | |||
4zif-B-A | |||
6qg8-B-A | |||
2m04-B-A | |||
4zih-B-A | |||
2roc-B-A | |||
5c6h-B-A | |||
2rod-B-A | |||
5fmk-B-A | |||
2v6q-B-A | |||
5twa-D-A | |||
5twa-C-B | |||
5tzp-B-A | |||
5tzq-C-B | |||
5tzq-D-A | |||
2wh6-B-A | |||
5ua5-B-A | |||
2xpx-B-A | |||
3io8-D-C | |||
5uum-C-A |