| Description | Induced myeloid leukemia cell differentiation protein Mcl-1 homolog |
|---|---|
| Organism | Mus musculus |
| Chain | A |
| Length | 162 |
| Binding Area (Å2) | 1054.22 |
| Molecular Weight | 18232.43 |
| Aromaticity | 0.09 |
| Instability | 34.62 |
| Isoelectric Point | 8.20 |
| Sequence | GPLGSEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGG |
| Description | Noxa |
|---|---|
| Organism | Mus musculus |
| Chain | B |
| Length | 27 |
| Binding Area (Å2) | 1140.29 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 3037.47 |
| Aromaticity | 0.11 |
| Instability | 36.09 |
| Isoelectric Point | 4.78 |
| Sequence | AELPPEFAAQLRKIGDKVYCTWSAPDM |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S35) |
Contact cluster (C60) |
Interface cluster (I55) |
|---|---|---|---|
| 2jm6-A-B | |||
| 2roc-B-A | |||
| 5c6h-B-A | |||
| 5uum-C-A | |||
| 5uum-D-B | |||
| 2kbw-B-A | |||
| 6mbe-B-A | |||
| 6qfi-B-A | |||
| 3d7v-B-A | |||
| 3kz0-C-A | |||
| 3kz0-D-B | |||
| 2jby-B-A | |||
| 4bd6-C-A | |||
| 6fbx-B-A | |||
| 4uf1-B-A | |||
| 6mbc-B-A | |||
| 4zif-B-A | |||
| 2m04-B-A | |||
| 4zih-B-A | |||
| 6qg8-B-A | |||
| 2v6q-B-A | |||
| 5fmk-B-A | |||
| 2vog-B-A | |||
| 5twa-D-A | |||
| 2voh-B-A | |||
| 5twa-C-B | |||
| 2wh6-B-A | |||
| 5tzp-B-A | |||
| 2xpx-B-A | |||
| 5tzq-C-B | |||
| 5tzq-D-A | |||
| 3i1h-B-A | |||
| 5ua5-B-A | |||
| 3io8-D-C | |||
| 5uuk-B-A | |||
| 1bxl-B-A | |||
| 1g5j-B-A | |||
| 3mqp-B-A | |||
| 5vmo-B-A |