| Description | Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|---|
| Organism | Homo sapiens |
| Chain | A |
| Length | 146 |
| Binding Area (Å2) | 948.83 |
| Molecular Weight | - |
| Aromaticity | 0.08 |
| Instability | - |
| Isoelectric Point | 8.80 |
| Sequence | DELYRQSLEIISRYLREQATGAKDGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVXXX |
| Description | Mcl-1 specific peptide MB7 |
|---|---|
| Organism | - |
| Chain | C |
| Length | 23 |
| Binding Area (Å2) | 1104.02 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 2792.03 |
| Aromaticity | 0.13 |
| Instability | 84.65 |
| Isoelectric Point | 6.26 |
| Sequence | RPEIWAAQEIRRIGDENNAYYAR |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S165) |
Contact cluster (C60) |
Interface cluster (I55) |
|---|---|---|---|
| 6qfi-B-A | |||
| 3d7v-B-A | |||
| 3kz0-D-B | |||
| 5uum-D-B | |||
| 2kbw-B-A | |||
| 2roc-B-A | |||
| 2rod-B-A | |||
| 6mbe-B-A | |||
| 5c6h-B-A | |||
| 2jm6-A-B | |||
| 5uum-C-A | |||
| 2k7w-B-A | |||
| 5vwv-B-A | |||
| 5wos-B-A | |||
| 2vm6-B-A | |||
| 3fdl-B-A | |||
| 3io8-B-A | |||
| 4b4s-B-A | |||
| 4d2m-B-A | |||
| 4d2m-D-C | |||
| 4qvf-B-A | |||
| 4zie-C-A | |||
| 1pq1-B-A |