| Description | Bcl-2-related protein A1 |
|---|---|
| Organism | Homo sapiens |
| Chain | A |
| Length | 152 |
| Binding Area (Å2) | 821.37 |
| Molecular Weight | 17425.75 |
| Aromaticity | 0.12 |
| Instability | 20.61 |
| Isoelectric Point | 5.27 |
| Sequence | GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK |
| Description | Bfl-1-specific selected peptide |
|---|---|
| Organism | synthetic construct |
| Chain | B |
| Length | 22 |
| Binding Area (Å2) | 954.94 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 2467.70 |
| Aromaticity | 0.05 |
| Instability | 41.95 |
| Isoelectric Point | 5.00 |
| Sequence | QWVREIAAGLRRAADDVNAQVE |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S35) |
Contact cluster (C84) |
Interface cluster (I84) |
|---|---|---|---|
| 2vog-B-A | |||
| 2voh-B-A | |||
| 3i1h-B-A | |||
| 3mqp-B-A | |||
| 6mbc-B-A | |||
| 2voi-B-A | |||
| 4zeq-B-A | |||
| 2vm6-B-A | |||
| 5twa-C-B | |||
| 5tzp-B-A | |||
| 5tzq-C-B | |||
| 2wh6-B-A | |||
| 5tzq-D-A | |||
| 2xpx-B-A | |||
| 5ua5-B-A | |||
| 5uum-C-A | |||
| 3io8-D-C | |||
| 5uum-D-B | |||
| 1bxl-B-A | |||
| 5vmo-B-A | |||
| 1g5j-B-A | |||
| 4bd6-C-A | |||
| 6fbx-B-A | |||
| 2jby-B-A | |||
| 4uf1-B-A | |||
| 2jm6-A-B | |||
| 6qg8-B-A | |||
| 2m04-B-A | |||
| 4zif-B-A | |||
| 2roc-B-A | |||
| 4zih-B-A | |||
| 2rod-B-A | |||
| 5c6h-B-A | |||
| 2v6q-B-A | |||
| 5fmk-B-A | |||
| 5twa-D-A |