| Description | 5-HL |
|---|---|
| Organism | African swine fever virus |
| Chain | A |
| Length | 144 |
| Binding Area (Å2) | 713.66 |
| Molecular Weight | 16812.10 |
| Aromaticity | 0.13 |
| Instability | 45.31 |
| Isoelectric Point | 5.43 |
| Sequence | EGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECLNKQVTITFLTSVQEIKTQFTGVVTELFKDLINWGRICGFIVFSAKMAKYCKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDM |
| Description | Uncharacterized protein |
|---|---|
| Organism | Sus scrofa |
| Chain | B |
| Length | 19 |
| Binding Area (Å2) | 836.69 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 2136.38 |
| Aromaticity | 0.00 |
| Instability | 71.23 |
| Isoelectric Point | 5.94 |
| Sequence | STKKLSECLKRIGDELDSN |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S35) |
Contact cluster (C373) |
Interface cluster (I1460) |
|---|---|---|---|
| 6tzc-C-B | |||
| 5vmo-B-A | |||
| 3io8-D-C | |||
| 6fbx-B-A | |||
| 3mqp-B-A | |||
| 4bd6-C-A | |||
| 6mbc-B-A | |||
| 4uf1-B-A | |||
| 6qg8-B-A | |||
| 1bxl-B-A | |||
| 4zif-B-A | |||
| 1g5j-B-A | |||
| 4zih-B-A | |||
| 2jby-B-A | |||
| 5c6h-B-A | |||
| 2jm6-A-B | |||
| 5fmk-B-A | |||
| 2m04-B-A | |||
| 5twa-D-A | |||
| 2roc-B-A | |||
| 5twa-C-B | |||
| 2rod-B-A | |||
| 5tzp-B-A | |||
| 2v6q-B-A | |||
| 5tzq-C-B | |||
| 2vog-B-A | |||
| 5tzq-D-A | |||
| 2voh-B-A | |||
| 5uuk-B-A | |||
| 2wh6-B-A | |||
| 5uum-C-A | |||
| 2xpx-B-A | |||
| 5uum-D-B | |||
| 3i1h-B-A |