| Description | Bak protein |
|---|---|
| Organism | Singapore grouper iridovirus |
| Chain | A |
| Length | 116 |
| Binding Area (Å2) | 815.31 |
| Molecular Weight | - |
| Aromaticity | 0.09 |
| Instability | - |
| Isoelectric Point | 6.79 |
| Sequence | INFSALLRGERMCPLTREIHSQMLIVTKSYSLVETFRAFPRLPNILEIGNNIVSDGNLNWGRILILLGISQLYFTKSESESERTQITEQLERFFRQDAISNWIASNGGWVTCASLX |
| Description | Bcl-2 interacting mediator of cell death |
|---|---|
| Organism | Danio rerio |
| Chain | B |
| Length | 24 |
| Binding Area (Å2) | 915.94 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 2848.31 |
| Aromaticity | 0.08 |
| Instability | 64.77 |
| Isoelectric Point | 6.29 |
| Sequence | ALPPEMVVARELRRIGDEFNRLYC |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S35) |
Contact cluster (C1402) |
Interface cluster (I1466) |
|---|---|---|---|
| 2rod-B-A | |||
| 5twa-C-B | |||
| 2v6q-B-A | |||
| 5tzp-B-A | |||
| 2vog-B-A | |||
| 5tzq-C-B | |||
| 2voh-B-A | |||
| 5tzq-D-A | |||
| 2wh6-B-A | |||
| 5ua5-B-A | |||
| 2xpx-B-A | |||
| 5uuk-B-A | |||
| 3i1h-B-A | |||
| 5uum-C-A | |||
| 3io8-D-C | |||
| 5uum-D-B | |||
| 3mqp-B-A | |||
| 6fbx-B-A | |||
| 4bd6-C-A | |||
| 6mbc-B-A | |||
| 1bxl-B-A | |||
| 4uf1-B-A | |||
| 6qg8-B-A | |||
| 1g5j-B-A | |||
| 4zif-B-A | |||
| 2jby-B-A | |||
| 4zih-B-A | |||
| 2jm6-A-B | |||
| 5c6h-B-A | |||
| 2m04-B-A | |||
| 5fmk-B-A | |||
| 2roc-B-A | |||
| 5twa-D-A |