Description | Gamma-aminobutyric acid receptor-associated protein-like 1 |
---|---|
Organism | Mus musculus |
Chain | A |
Length | 123 |
Binding Area (Å2) | 748.03 |
Molecular Weight | 14618.46 |
Aromaticity | 0.15 |
Instability | 37.41 |
Isoelectric Point | 8.04 |
Sequence | GPGSEFMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
Description | Ankyrin-3 |
---|---|
Organism | Rattus norvegicus |
Chain | B |
Length | 23 |
Binding Area (Å2) | 924.10 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 2661.70 |
Aromaticity | 0.09 |
Instability | 75.00 |
Isoelectric Point | 4.25 |
Sequence | PEDDWTEFSSEEIREARQAAASH |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S382) |
Contact cluster (C24) |
Interface cluster (I45) |
---|---|---|---|
6a9x-A-D | |||
4xc2-F-B | |||
6aaf-B-A | |||
6hoi-F-B | |||
6hol-C-A | |||
6hol-D-B | |||
5l83-D-A | |||
5lxh-E-A | |||
5lxh-F-B | |||
5lxh-G-C | |||
5azf-C-A | |||
5l83-C-B | |||
2l8j-B-A | |||
5yis-D-B | |||
5cx3-E-A | |||
5cx3-F-B | |||
5cx3-G-C | |||
5cx3-H-D | |||
5d94-B-A | |||
5dpw-H-G | |||
5dpw-J-I | |||
5dpw-N-M | |||
2k6q-B-A | |||
2zjd-B-A | |||
2zjd-D-C | |||
5wrd-C-A |