Description | Microtubule-associated proteins 1A/1B light chain 3B precursor |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 122 |
Binding Area (Å2) | 492.09 |
Molecular Weight | 14388.49 |
Aromaticity | 0.09 |
Instability | 64.45 |
Isoelectric Point | 8.89 |
Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMK |
Description | undecameric peptide from Sequestosome-1 |
---|---|
Organism | Mus musculus |
Chain | D |
Length | 7 |
Binding Area (Å2) | 640.40 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 872.88 |
Aromaticity | 0.14 |
Instability | -12.90 |
Isoelectric Point | 4.20 |
Sequence | DDWTHLS |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S630) |
Contact cluster (C24) |
Interface cluster (I39) |
---|---|---|---|
2zjd-B-A | |||
2k6q-B-A | |||
5wrd-C-A | |||
5cx3-E-A | |||
5yis-D-B | |||
5cx3-F-B | |||
5cx3-G-C | |||
5cx3-H-D | |||
5d94-B-A | |||
5dpw-H-G | |||
5dpw-J-I | |||
5dpw-N-M | |||
5e6o-G-C | |||
5e6o-H-A | |||
5l83-D-A | |||
5lxh-E-A | |||
5lxh-F-B | |||
5lxh-G-C | |||
4xc2-F-B | |||
5yip-B-A | |||
6a9x-A-D | |||
6aaf-B-A | |||
6hoi-F-B | |||
6hol-C-A | |||
6hol-D-B |