Description | Autophagy-related protein |
---|---|
Organism | Solanum tuberosum |
Chain | A |
Length | 112 |
Binding Area (Å2) | 372.46 |
Molecular Weight | 12941.83 |
Aromaticity | 0.10 |
Instability | 40.98 |
Isoelectric Point | 8.11 |
Sequence | GPSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEEHKDEDGFLYMTYSGEN |
Description | ASP-TRP-GLU-ILE-VAL |
---|---|
Organism | Phytophthora infestans |
Chain | D |
Length | 5 |
Binding Area (Å2) | 552.04 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 660.72 |
Aromaticity | 0.20 |
Instability | 29.54 |
Isoelectric Point | 3.67 |
Sequence | DWEIV |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S652) |
Contact cluster (C24) |
Interface cluster (I45) |
---|---|---|---|
5lxh-E-A | |||
5lxh-F-B | |||
5lxh-G-C | |||
5yip-B-A | |||
4xc2-F-B | |||
6a9x-A-D | |||
6aaf-B-A | |||
6hoi-F-B | |||
6hol-C-A | |||
6hol-D-B | |||
5l83-C-B | |||
2l8j-B-A | |||
5azf-C-A | |||
5dpw-N-M | |||
2k6q-B-A | |||
2zjd-B-A | |||
5wrd-C-A | |||
2zjd-D-C | |||
5yis-D-B | |||
5cx3-E-A | |||
5cx3-F-B | |||
5cx3-G-C | |||
5cx3-H-D | |||
5d94-B-A | |||
5dpw-H-G | |||
5dpw-J-I |