Description | Microtubule-associated proteins 1A/1B light chain 3B |
---|---|
Organism | Rattus norvegicus |
Chain | A |
Length | 121 |
Binding Area (Å2) | 599.92 |
Molecular Weight | 14230.18 |
Aromaticity | 0.09 |
Instability | 67.51 |
Isoelectric Point | 7.98 |
Sequence | SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG |
Description | p62_peptide from Sequestosome-1 |
---|---|
Organism | Rattus norvegicus |
Chain | B |
Length | 17 |
Binding Area (Å2) | 823.08 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1878.92 |
Aromaticity | 0.06 |
Instability | 36.16 |
Isoelectric Point | 4.19 |
Sequence | MSGGDDDWTHLSSKEVD |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S1041) |
Contact cluster (C24) |
Interface cluster (I39) |
---|---|---|---|
5dpw-H-G | |||
5dpw-J-I | |||
5dpw-N-M | |||
2zjd-B-A | |||
2zjd-D-C | |||
5wrd-C-A | |||
5cx3-E-A | |||
5yis-D-B | |||
5cx3-F-B | |||
5cx3-G-C | |||
5cx3-H-D | |||
5d94-B-A | |||
5e6o-G-C | |||
5e6o-H-A | |||
6hol-D-B | |||
5l83-D-A | |||
5lxh-E-A | |||
5lxh-F-B | |||
5lxh-G-C | |||
4xc2-F-B | |||
5yip-B-A | |||
6a9x-A-D | |||
6aaf-B-A | |||
6hoi-F-B | |||
6hol-C-A |