Description | Gamma-aminobutyric acid receptor-associated protein-like 1 |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 115 |
Binding Area (Å2) | 531.11 |
Molecular Weight | 13782.56 |
Aromaticity | 0.15 |
Instability | 39.78 |
Isoelectric Point | 7.86 |
Sequence | SMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESV |
Description | Cysteine protease ATG4B |
---|---|
Organism | Homo sapiens |
Chain | E |
Length | 10 |
Binding Area (Å2) | 679.70 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1209.26 |
Aromaticity | 0.10 |
Instability | 78.50 |
Isoelectric Point | 3.39 |
Sequence | EDEDFEILSL |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S212) |
Contact cluster (C24) |
Interface cluster (I45) |
---|---|---|---|
5lxh-F-B | |||
5lxh-G-C | |||
4xc2-F-B | |||
5yip-B-A | |||
6a9x-A-D | |||
6aaf-B-A | |||
6hoi-F-B | |||
6hol-C-A | |||
6hol-D-B | |||
5l83-D-A | |||
2l8j-B-A | |||
5azf-C-A | |||
5l83-C-B | |||
2zjd-B-A | |||
2zjd-D-C | |||
5wrd-C-A | |||
5cx3-E-A | |||
5cx3-F-B | |||
5yis-D-B | |||
5cx3-G-C | |||
5cx3-H-D | |||
5d94-B-A | |||
5dpw-H-G | |||
5dpw-J-I | |||
5dpw-N-M | |||
2k6q-B-A | |||
5nq0-C-A | |||
3l6x-B-A | |||
5nq1-C-A | |||
5nq1-F-D | |||
6j2i-C-A | |||
1ty4-D-B | |||
6j2i-F-D |