Description | Protein lgg-1 |
---|---|
Organism | Caenorhabditis elegans |
Chain | A |
Length | 124 |
Binding Area (Å2) | 362.44 |
Molecular Weight | - |
Aromaticity | 0.13 |
Instability | - |
Isoelectric Point | 8.75 |
Sequence | GPHMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGXXXXX |
Description | peptide from Autophagy-related protein 19 |
---|---|
Organism | Saccharomyces cerevisiae |
Chain | C |
Length | 4 |
Binding Area (Å2) | 598.15 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 575.61 |
Aromaticity | 0.25 |
Instability | 89.00 |
Isoelectric Point | 3.79 |
Sequence | WEEL |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S55) |
Contact cluster (C1309) |
Interface cluster (I45) |
---|---|---|---|
2l8j-B-A | |||
6hol-C-A | |||
4xc2-F-B | |||
6hol-D-B | |||
5l83-C-B | |||
5l83-D-A | |||
5lxh-E-A | |||
5lxh-F-B | |||
5lxh-G-C | |||
5yip-B-A | |||
6a9x-A-D | |||
6aaf-B-A | |||
6hoi-F-B | |||
5b1z-C-A | |||
5b1z-D-B | |||
5e6o-G-C | |||
5e6o-H-A | |||
5fcg-C-A |