| Description | Glucocorticoid receptor |
|---|---|
| Organism | Homo sapiens |
| Chain | E |
| Length | 256 |
| Binding Area (Å2) | 586.25 |
| Molecular Weight | - |
| Aromaticity | 0.11 |
| Instability | - |
| Isoelectric Point | 7.83 |
| Sequence | ATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMALMAFALGWRSYRQSSANLLYFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKVLLLLSTIPKDGLKSQALFDAIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQKX |
| Description | Nuclear receptor coactivator 2 |
|---|---|
| Organism | Homo sapiens |
| Chain | F |
| Length | 14 |
| Binding Area (Å2) | 624.83 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1705.91 |
| Aromaticity | 0.07 |
| Instability | 11.59 |
| Isoelectric Point | 4.87 |
| Sequence | KENALLRYLLDKDD |
Is the complex classified in the same cluster?