| Description | Androgen receptor |
|---|---|
| Organism | Pan troglodytes |
| Chain | A |
| Length | 250 |
| Binding Area (Å2) | 571.38 |
| Molecular Weight | - |
| Aromaticity | 0.11 |
| Instability | - |
| Isoelectric Point | 8.94 |
| Sequence | QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTX |
| Description | FxxYF motif peptide |
|---|---|
| Organism | - |
| Chain | B |
| Length | 12 |
| Binding Area (Å2) | 634.69 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1547.73 |
| Aromaticity | 0.25 |
| Instability | -23.00 |
| Isoelectric Point | 8.31 |
| Sequence | SNTPRFKEYFMQ |
Is the complex classified in the same cluster?