| Description | Androgen receptor |
|---|---|
| Organism | Pan troglodytes |
| Chain | A |
| Length | 250 |
| Binding Area (Å2) | 467.32 |
| Molecular Weight | - |
| Aromaticity | 0.11 |
| Instability | - |
| Isoelectric Point | 8.94 |
| Sequence | QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTX |
| Description | WxxLF motif peptide |
|---|---|
| Organism | - |
| Chain | B |
| Length | 8 |
| Binding Area (Å2) | 520.15 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1022.11 |
| Aromaticity | 0.25 |
| Instability | 119.85 |
| Isoelectric Point | 5.81 |
| Sequence | SRWQALFD |
Is the complex classified in the same cluster?