| Description | Orphan nuclear receptor NR5A2 |
|---|---|
| Organism | Homo sapiens |
| Chain | A |
| Length | 235 |
| Binding Area (Å2) | 608.11 |
| Molecular Weight | - |
| Aromaticity | 0.09 |
| Instability | - |
| Isoelectric Point | 5.15 |
| Sequence | ASIPHLILELLKCEPDEPQVQAKIMAYLQQEQKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAXX |
| Description | Nuclear receptor coactivator 2 |
|---|---|
| Organism | Homo sapiens |
| Chain | P |
| Length | 11 |
| Binding Area (Å2) | 637.03 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1347.56 |
| Aromaticity | 0.09 |
| Instability | 12.03 |
| Isoelectric Point | 6.17 |
| Sequence | ENALLRYLLDK |
Is the complex classified in the same cluster?