| Description | Orphan nuclear receptor NR5A2 |
|---|---|
| Organism | Mus musculus |
| Chain | B |
| Length | 243 |
| Binding Area (Å2) | 491.02 |
| Molecular Weight | 28173.14 |
| Aromaticity | 0.09 |
| Instability | 42.66 |
| Isoelectric Point | 5.54 |
| Sequence | ASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEGTIFLVTGEHVDYSTIISHTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDVKNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKRA |
| Description | nuclear receptor subfamily 0, group B, member 2 |
|---|---|
| Organism | Rattus norvegicus |
| Chain | D |
| Length | 11 |
| Binding Area (Å2) | 520.36 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1244.44 |
| Aromaticity | 0.09 |
| Instability | 16.26 |
| Isoelectric Point | 6.46 |
| Sequence | SHPTILYTLLS |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S199) |
Contact cluster (C26) |
Interface cluster (I21) |
|---|---|---|---|
| 1zh7-C-A | |||
| 4dor-C-A | |||
| 4dor-D-B | |||
| 4oni-C-A | |||
| 4oni-D-B | |||
| 1yuc-C-A | |||
| 1yuc-D-B | |||
| 1zdu-P-A | |||
| 5l11-C-A | |||
| 5syz-C-A | |||
| 5unj-C-A | |||
| 3plz-C-A | |||
| 3plz-D-B | |||
| 4dos-B-A | |||
| 1yok-B-A | |||
| 4pld-B-A | |||
| 4ple-B-A | |||
| 4ple-H-G | |||
| 1ymt-B-A | |||
| 1yp0-B-A | |||
| 3f7d-B-A | |||
| 1zdt-P-A | |||
| 1zdt-Q-B | |||
| 4qjr-B-A | |||
| 6oqx-C-A | |||
| 6oqy-C-A | |||
| 6or1-C-A | |||
| 4dos-C-A | |||
| 1yok-C-A | |||
| 2q3y-B-A |