Description | JmjC domain-containing protein 5 |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 238 |
Binding Area (Å2) | 348.18 |
Molecular Weight | - |
Aromaticity | 0.12 |
Instability | - |
Isoelectric Point | 5.32 |
Sequence | STVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPAMQKWSLEYIQEIAGARTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYASLGDGEEEEITIXAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSAILSPGEILFIPVKYWHYVRALDLSFSVSFWWSXXX |
Description | RCC1 domain-containing protein 1 |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 4 |
Binding Area (Å2) | 488.59 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 419.50 |
Aromaticity | 0.00 |
Instability | 7.50 |
Isoelectric Point | 8.25 |
Sequence | CARA |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S135) |
Contact cluster (C205) |
Interface cluster (I515) |
---|---|---|---|
6f4s-B-A | |||
6f4q-B-A | |||
6f4t-B-A | |||
3uvn-B-A | |||
3uvn-D-C | |||
3uvo-B-A | |||
4erq-D-A | |||
4erq-E-B | |||
4ery-D-A | |||
4erz-D-C | |||
4erz-E-A | |||
4erz-F-B | |||
4es0-C-A | |||
2l8j-B-A | |||
4esg-C-B | |||
3eg6-C-A | |||
4esg-D-A | |||
3emh-B-A | |||
4ewr-C-A | |||
3p4f-C-A | |||
3uvk-B-A | |||
3uvl-B-A | |||
3uvm-B-A |