Description | Mature alpha chain of major histocompatibility complex class I antigen (HEAVY CHAIN) |
---|---|
Organism | Rattus norvegicus |
Chain | A |
Length | 276 |
Binding Area (Å2) | 668.34 |
Molecular Weight | 31904.05 |
Aromaticity | 0.12 |
Instability | 39.86 |
Isoelectric Point | 5.32 |
Sequence | GSHSLRYFDIAVSRPGLGEPRYISVGYVDDTEFARYDSDAENRRYQPRARWMEREGPEYWERNTPIYKGKEQTFRVNLRTLRGYYNQSEGGSHTIQEMYGCDVGSDGSLLRGYEQFAYDGRDYIALNEDLKTWTAADFAARISRNKLERDGFADLHRAYLEGECVESLRRYLELGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVEHEGLPKPLSQRWEP |
Description | peptide NPR |
---|---|
Organism | Rattus norvegicus |
Chain | P |
Length | 9 |
Binding Area (Å2) | 1029.55 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1013.21 |
Aromaticity | 0.00 |
Instability | -11.07 |
Isoelectric Point | 9.75 |
Sequence | NPRAMQALL |
Is the complex classified in the same cluster?