Description | H-2 class I histocompatibility antigen, D-B alpha chain |
---|---|
Organism | Mus musculus |
Chain | A |
Length | 262 |
Binding Area (Å2) | 683.27 |
Molecular Weight | 30594.71 |
Aromaticity | 0.13 |
Instability | 41.11 |
Isoelectric Point | 5.59 |
Sequence | GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPREVTLRCWALGFYPADITLTWQGEEMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE |
Description | Pre-glycoprotein polyprotein GP complex |
---|---|
Organism | Lymphocytic choriomeningitis mammarenavirus |
Chain | C |
Length | 9 |
Binding Area (Å2) | 1132.79 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 952.13 |
Aromaticity | 0.11 |
Instability | -7.81 |
Isoelectric Point | 8.75 |
Sequence | KAVANFATM |
Is the complex classified in the same cluster?