Description | H-2 class I histocompatibility antigen, K-D alpha chain |
---|---|
Organism | Mus musculus |
Chain | C |
Length | 274 |
Binding Area (Å2) | 752.11 |
Molecular Weight | 31946.18 |
Aromaticity | 0.14 |
Instability | 39.03 |
Isoelectric Point | 5.46 |
Sequence | GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRW |
Description | 9-mer peptide from Spike protein |
---|---|
Organism | Middle East respiratory syndrome-related coronavirus |
Chain | Q |
Length | 9 |
Binding Area (Å2) | 1185.07 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1050.16 |
Aromaticity | 0.22 |
Instability | 44.00 |
Isoelectric Point | 6.74 |
Sequence | YYSIAPHSI |
Is the complex classified in the same cluster?