Description | H-2 class I histocompatibility antigen, K-D alpha chain |
---|---|
Organism | Mus musculus |
Chain | C |
Length | 275 |
Binding Area (Å2) | 776.96 |
Molecular Weight | 32123.42 |
Aromaticity | 0.13 |
Instability | 38.40 |
Isoelectric Point | 5.67 |
Sequence | PHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKP |
Description | Peptide (P9) of Mtb85B (Mycobacterium tuberculosis) YQSGLSIVM |
---|---|
Organism | Mycobacterium tuberculosis |
Chain | Q |
Length | 9 |
Binding Area (Å2) | 1108.50 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 997.17 |
Aromaticity | 0.11 |
Instability | 48.28 |
Isoelectric Point | 5.52 |
Sequence | YQSGLSIVM |
Is the complex classified in the same cluster?