Description | Protein Mdm4 |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 88 |
Binding Area (Å2) | 500.87 |
Molecular Weight | - |
Aromaticity | 0.08 |
Instability | - |
Isoelectric Point | 8.07 |
Sequence | QINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLX |
Description | pDI6W peptide (12mer) |
---|---|
Organism | - |
Chain | P |
Length | 12 |
Binding Area (Å2) | 617.06 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1518.67 |
Aromaticity | 0.25 |
Instability | -1.76 |
Isoelectric Point | 5.24 |
Sequence | LTFEHWWAQLTS |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S166) |
Contact cluster (C46) |
Interface cluster (I31) |
---|---|---|---|
3jzo-P-A | |||
3jzq-P-A | |||
3jzq-Q-B | |||
3jzr-P-A | |||
3jzs-P-A | |||
3dab-D-C | |||
3dab-H-G | |||
3eqs-B-A | |||
3eqy-D-B | |||
3lnz-J-I | |||
3lnz-L-K | |||
1t4f-P-M | |||
1ycq-B-A | |||
3dab-B-A | |||
2mps-B-A | |||
2mwy-B-A | |||
3u9z-C-A | |||
6ijq-A-B | |||
6t2e-B-A | |||
1sqk-B-A | |||
3sjh-B-A | |||
3u8x-B-A | |||
3u8x-D-C | |||
3u9d-B-A | |||
3u9d-D-C |