Description | Eukaryotic transcription initiation factor 4E |
---|---|
Organism | Cucumis melo |
Chain | A |
Length | 152 |
Binding Area (Å2) | 1339.58 |
Molecular Weight | 17562.52 |
Aromaticity | 0.15 |
Instability | 29.66 |
Isoelectric Point | 5.84 |
Sequence | QPHPLEHSWTFWFDNPSSIRPIYTFSTVEEFWSVYNNIHHPSKLAMRADLYCFKHKIEPKWEDPVCANGGKWTVNFPRGKSDNGWLYTLLAMIGEQFDCGDEICGAVVNVRSGQDKISIWTKNASNEAAQASIGKQWKEFLDYNESIGFIFH |
Description | eIF4G |
---|---|
Organism | Cucumis melo |
Chain | B |
Length | 37 |
Binding Area (Å2) | 1386.26 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 4402.89 |
Aromaticity | 0.14 |
Instability | 41.88 |
Isoelectric Point | 5.41 |
Sequence | KKYSRDFLLKFAEQFLDLPHNFEVTSDIESLMSTHTN |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S219) |
Contact cluster (C22) |
Interface cluster (I1432) |
---|---|---|---|
2w97-E-A | |||
2w97-F-B | |||
1ejh-E-A | |||
1ejh-F-B | |||
1ejh-G-C | |||
5ehc-B-A | |||
1ejh-H-D | |||
5ei3-B-A | |||
1wkw-B-A | |||
5nvn-D-C | |||
2jgc-B-A | |||
5t48-B-A | |||
2v8w-B-A | |||
5xln-B-A | |||
2v8x-B-A | |||
2v8y-B-A | |||
3am7-B-A | |||
3m94-C-A | |||
3u7x-C-A | |||
3u7x-D-B | |||
1ej4-B-A | |||
4ue9-B-A | |||
4ued-B-A | |||
5aby-B-A |