Description | Eukaryotic translation initiation factor 4E |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 187 |
Binding Area (Å2) | 664.63 |
Molecular Weight | - |
Aromaticity | 0.12 |
Instability | - |
Isoelectric Point | 7.19 |
Sequence | EVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATTKNRFVVX |
Description | Eukaryotic translation initiation factor 4 gamma 1 |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 14 |
Binding Area (Å2) | 678.21 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1847.12 |
Aromaticity | 0.29 |
Instability | 33.33 |
Isoelectric Point | 9.70 |
Sequence | KKRYDREFLLGFQF |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S219) |
Contact cluster (C22) |
Interface cluster (I30) |
---|---|---|---|
1ejh-F-B | |||
1ejh-G-C | |||
5ei3-B-A | |||
1ejh-H-D | |||
2w97-E-A | |||
2w97-F-B | |||
1ejh-E-A | |||
1wkw-B-A | |||
2v8w-B-A | |||
2v8x-B-A | |||
2v8y-B-A | |||
3am7-B-A | |||
3m94-C-A | |||
3u7x-C-A | |||
3u7x-D-B | |||
1ej4-B-A | |||
5me5-B-A | |||
5aby-B-A | |||
5nvn-D-C | |||
2jgc-B-A | |||
5t48-B-A | |||
5xln-B-A | |||
4ue9-B-A | |||
4ued-B-A |