Description | Eukaryotic translation initiation factor 4E type 2 |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 166 |
Binding Area (Å2) | 1267.01 |
Molecular Weight | 19391.02 |
Aromaticity | 0.11 |
Instability | 43.25 |
Isoelectric Point | 8.59 |
Sequence | GPHMLEAEHPLQYNYTFWYSRRNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMP |
Description | Eukaryotic translation initiation factor 4E-binding protein 1 |
---|---|
Organism | Homo sapiens |
Chain | D |
Length | 35 |
Binding Area (Å2) | 1396.17 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 4034.73 |
Aromaticity | 0.06 |
Instability | 50.82 |
Isoelectric Point | 9.78 |
Sequence | MTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTS |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S193) |
Contact cluster (C22) |
Interface cluster (I1439) |
---|---|---|---|
2jgc-B-A | |||
2v8w-B-A | |||
2v8x-B-A | |||
2v8y-B-A | |||
3m94-C-A | |||
1ej4-B-A | |||
3u7x-C-A | |||
3u7x-D-B | |||
4ued-B-A | |||
1ejh-H-D | |||
5aby-B-A | |||
1wkw-B-A | |||
5ehc-B-A | |||
5ei3-B-A | |||
5me5-B-A | |||
5t48-B-A | |||
5xln-B-A | |||
2w97-E-A | |||
2w97-F-B | |||
3am7-B-A | |||
1ejh-E-A | |||
1ejh-F-B | |||
4ue9-B-A | |||
1ejh-G-C | |||
3hxg-C-A | |||
3hxi-C-A |