| Description | PHD finger protein 21A |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 62 |
| Binding Area (Å2) | 481.25 |
| Molecular Weight | - |
| Aromaticity | 0.05 |
| Instability | - |
| Isoelectric Point | 6.97 |
| Sequence | HMIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIXX |
| Description | Histone H3 |
|---|---|
| Organism | Homo sapiens |
| Chain | E |
| Length | 10 |
| Binding Area (Å2) | 607.02 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1146.30 |
| Aromaticity | 0.00 |
| Instability | 32.64 |
| Isoelectric Point | 12.02 |
| Sequence | ARTKQTARKS |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S46) |
Contact cluster (C970) |
Interface cluster (I931) |
|---|---|---|---|
| 3zvy-C-A | |||
| 3zvy-D-B | |||
| 4gne-B-A | |||
| 2co0-B-A | |||
| 4gnf-C-A | |||
| 2co0-D-C | |||
| 4lk9-B-A | |||
| 2h9m-B-A | |||
| 4ouc-B-A | |||
| 2ke1-B-A | |||
| 4qbr-P-A | |||
| 2lgg-B-A | |||
| 4qbr-E-C | |||
| 3asl-B-A | |||
| 5f6k-M-C | |||
| 3o37-F-B | |||
| 5fb1-C-A | |||
| 3qlc-C-A | |||
| 5hh7-P-A | |||
| 3shb-B-A | |||
| 6e83-A-B | |||
| 3sou-D-A | |||
| 6ieu-C-A | |||
| 3sou-E-B | |||
| 3uef-B-A | |||
| 3v43-Q-A |