| Description | Origin of replication complex subunit 1B |
|---|---|
| Organism | Arabidopsis thaliana |
| Chain | A |
| Length | 194 |
| Binding Area (Å2) | 651.59 |
| Molecular Weight | - |
| Aromaticity | 0.12 |
| Instability | - |
| Isoelectric Point | 4.84 |
| Sequence | KRVYYNKVEFDETEFEIGDDVYVKRREDEDPEIEDCQICFKSDTNIMIECDDCLGGFHLKCLKPPLKEVPEGDWICQFCEVKARTMREKLLSGDLWAARIDKLWKEVDDGVYWIRARWYMIPEETVSGRQPHNLKRELYLTNDFADIEMECILRHCSVKCPKEFSKASNDGDDVFLCEYEYDVHWRSFKRLAXX |
| Description | Histone H3 1-15 peptide |
|---|---|
| Organism | Arabidopsis thaliana |
| Chain | P |
| Length | 9 |
| Binding Area (Å2) | 911.33 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1059.22 |
| Aromaticity | 0.00 |
| Instability | 35.16 |
| Isoelectric Point | 12.02 |
| Sequence | ARTKQTARK |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S46) |
Contact cluster (C1352) |
Interface cluster (I1387) |
|---|---|---|---|
| 3uef-B-A | |||
| 3v43-Q-A | |||
| 3zvy-C-A | |||
| 3zvy-D-B | |||
| 2co0-B-A | |||
| 4gne-B-A | |||
| 2co0-D-C | |||
| 4gnf-C-A | |||
| 2h9m-B-A | |||
| 4lk9-B-A | |||
| 2ke1-B-A | |||
| 4ouc-B-A | |||
| 2lgg-B-A | |||
| 4qbr-P-A | |||
| 2puy-E-B | |||
| 4qbr-E-C | |||
| 3asl-B-A | |||
| 5f6k-M-C | |||
| 3o37-F-B | |||
| 5fb1-C-A | |||
| 3qlc-C-A | |||
| 6e83-A-B | |||
| 3shb-B-A | |||
| 6ieu-C-A | |||
| 3sou-D-A | |||
| 3sou-E-B |