| Description | E3 ubiquitin-protein ligase UHRF1 |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 73 |
| Binding Area (Å2) | 369.88 |
| Molecular Weight | - |
| Aromaticity | 0.05 |
| Instability | - |
| Isoelectric Point | 4.70 |
| Sequence | GPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDAXXXX |
| Description | Histone H3 |
|---|---|
| Organism | Homo sapiens |
| Chain | E |
| Length | 8 |
| Binding Area (Å2) | 499.33 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 931.05 |
| Aromaticity | 0.00 |
| Instability | 38.30 |
| Isoelectric Point | 12.01 |
| Sequence | ARTKQTAR |
Is the complex classified in the same cluster?
| Complex |
Sequence cluster (S46) |
Contact cluster (C108) |
Interface cluster (I132) |
|---|---|---|---|
| 3asl-B-A | |||
| 3shb-B-A | |||
| 3sou-D-A | |||
| 3zvy-C-A | |||
| 3zvy-D-B | |||
| 6iiw-B-A | |||
| 2h9m-B-A | |||
| 4ouc-B-A | |||
| 2ke1-B-A | |||
| 4qbr-P-A | |||
| 2lgg-B-A | |||
| 4qbr-E-C | |||
| 2puy-E-B | |||
| 5f6k-M-C | |||
| 5fb1-C-A | |||
| 3o37-F-B | |||
| 5hh7-P-A | |||
| 3qlc-C-A | |||
| 6e83-A-B | |||
| 6ieu-C-A | |||
| 3uef-B-A | |||
| 3v43-Q-A | |||
| 4gne-B-A | |||
| 2co0-B-A | |||
| 4gnf-C-A | |||
| 2co0-D-C | |||
| 4lk9-B-A |