| Description | Bile acid receptor |
|---|---|
| Organism | Rattus norvegicus |
| Chain | B |
| Length | 230 |
| Binding Area (Å2) | 473.65 |
| Molecular Weight | - |
| Aromaticity | 0.09 |
| Instability | - |
| Isoelectric Point | 5.23 |
| Sequence | AELTVDQQTLLDYIMDSYSKQRMPQEITNKILKEEFSAEENFLILTEMATSHVQILVEFTKRLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPAGHADLLEERIRKSGISDEYITPMFSFYKSVGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIYQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVX |
| Description | Nuclear receptor coactivator 2 |
|---|---|
| Organism | Mus musculus |
| Chain | E |
| Length | 12 |
| Binding Area (Å2) | 506.59 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1462.65 |
| Aromaticity | 0.08 |
| Instability | 11.86 |
| Isoelectric Point | 4.78 |
| Sequence | ENALLRYLLDKD |
Is the complex classified in the same cluster?